PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00029.440
Common NameAMTR_s00029p00245970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family TCP
Protein Properties Length: 128aa    MW: 14211.9 Da    PI: 10.4085
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00029.440genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP94.32.4e-2937104471
                                       TCP   4 kkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssas 71 
                                                kdrhsk++T +g+RdR vRl a++a++f+d+qd  G+d++sk+++WL+++akpai+el + +  ++s
  evm_27.model.AmTr_v1.0_scaffold00029.440  37 WKDRHSKVCTVKGPRDRCVRLTAHTAIQFYDVQDWRGYDRPSKAVDWLINKAKPAIDELKKRTHGQSS 104
                                               59**********************************************************99444432 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136928.6043795IPR017887Transcription factor TCP subgroup
PfamPF036349.8E-2738102IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
PENSSENQRR RLSFQSRGGR GEIVEVEGGH IVRAIGWKDR HSKVCTVKGP RDRCVRLTAH  60
TAIQFYDVQD WRGYDRPSKA VDWLINKAKP AIDELKKRTH GQSSSHGNAP CPFGEVDLGG  120
APHKRSA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19599KKRTH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011623141.13e-79PREDICTED: transcription factor PCF5, partial
SwissprotQ8LPR52e-39TCP4_ARATH; Transcription factor TCP4
TrEMBLW1PPS95e-91W1PPS9_AMBTC; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000397863e-38(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15030.31e-29TCP family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]